DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and fray

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster


Alignment Length:448 Identity:146/448 - (32%)
Similarity:205/448 - (45%) Gaps:83/448 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 TNHHSSASSFSSFPS-FHDDDGTHHAL---------PTIHCPTPTSSSRNSTVSFPV-------A 473
            |.......|.:..|| :...|...|.:         |....|.|.::.|:.  |.|.       .
  Fly    75 TEQEQRRESENEHPSVYRQQDEEFHPIKKEEPQKTPPISKQPRPRNTPRSQ--SQPAINNRRRPG 137

  Fly   474 VPLPPIVTPASPTPASIESPDLYTPEPTVAQVSAGGPSSQVAGNQIAVPQAAVAPAATPNTRAAN 538
            .|.|..|.|.:.|.:|          .::..:.|...|:.|||       ||..|.|     ||.
  Fly   138 TPPPHTVAPGNGTASS----------RSMTSIPANLSSNNVAG-------AATLPGA-----AAP 180

  Fly   539 AKKKKMSDEEILEKLRTIVSVGDPNRK--YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ 601
            .:|...                 ||.|  |...:.||.||:..|:.|.......:.|||::||.:
  Fly   181 PEKYTW-----------------PNSKDDYELRDVIGVGATAVVHGAYCIPRNEKCAIKRINLEK 228

  Fly   602 -QPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVV-----TETC---- 656
             ....:.::.||..|....|.|||.|..|::|.||||:|:..|.||||.|::     |..|    
  Fly   229 WNTSMDELLKEIQAMSSCFHENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGV 293

  Fly   657 MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQIS-----PEQSK 716
            .||..||.|.:|||:.||:.|:|..||||||:.|||:|.||::::.|||..|.::     ..|..
  Fly   294 FDEATIATVLKEVLKGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLATGRDLSRQKV 358

  Fly   717 RTTMVGTPYWMAPEVVTRKQ-YGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEI 780
            |.|.||||.||||||:.:.. |..|.|:||.||.||||..|..||....|:|.|.|...|..|.:
  Fly   359 RHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTL 423

  Fly   781 ----KEKDKLSS---AFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIM 831
                .:||:..:   .|:..:.:||:.|..:|.:|.:||||.|.|.|:....||..::
  Fly   424 DTGADDKDQYKAYGKTFRKMIVECLQKEPSKRPTASELLKHAFFKKAKDRKYLTQTLL 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 112/284 (39%)
S_TKc 566..817 CDD:214567 108/273 (40%)
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 108/275 (39%)
OSR1_C 613..670 CDD:403428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.