DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and stk4

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_989249.1 Gene:stk4 / 394860 XenbaseID:XB-GENE-955920 Length:485 Species:Xenopus tropicalis


Alignment Length:297 Identity:116/297 - (39%)
Similarity:184/297 - (61%) Gaps:13/297 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 KKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKE 606
            ||:|:|.:.::         |...:..:||:|:|:.|:||.|....|...|||||:.:....:: 
 Frog    15 KKLSEESLNKQ---------PEEVFDVLEKLGEGSYGSVYKASHKETSQIVAIKQIPVESDLQE- 69

  Fly   607 LIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVV--TETCMDEGQIAAVCREV 669
             ||.||.:|::....:||.|..||..:.:||:|||:..|||::|::  .:..:.|.:.|.:.:..
 Frog    70 -IIKEIAIMQQCDSLHVVKYYGSYFKNTDLWIVMEFCGGGSISDIIRLRKQTLKEDETATILQST 133

  Fly   670 LQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTR 734
            |:.||:||..:.||||||:.||||..:|:.||.|||...|::...:||.|::|||:||||||:..
 Frog   134 LKGLEYLHFMRKIHRDIKAGNILLNSEGTAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQE 198

  Fly   735 KQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLE 799
            ..|....|:|||||.||||.||:|||...:|::|:::|.:|..|..::.:..|..|.||::.||.
 Frog   199 IGYNCVADIWSLGITAIEMAEGKPPYAEIHPMRAIFMIPSNPPPTFRKPELWSKDFVDFINLCLV 263

  Fly   800 VEVDRRASALDLLKHPFLKLARPLASLTPLIMAAKEA 836
            ...:.|:||.:||:|||:|.|:..:.|..||..|::|
 Frog   264 KNPELRSSATELLQHPFIKTAKGESILRHLINEAQDA 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 105/261 (40%)
S_TKc 566..817 CDD:214567 103/252 (41%)
stk4NP_989249.1 STKc_MST1_2 26..281 CDD:132943 104/256 (41%)
Mst1_SARAH 431..478 CDD:314497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.