DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and oxsr1b

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_957469.2 Gene:oxsr1b / 394150 ZFINID:ZDB-GENE-040426-723 Length:520 Species:Danio rerio


Alignment Length:279 Identity:114/279 - (40%)
Similarity:159/279 - (56%) Gaps:23/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ-QPKKELIINEILVMRENKHPNVVNYLDS 629
            |...|.||.||:..|..|.......:||||::||.: |...:.::.||..|.:..|||:|:|..|
Zfish    17 YELQEVIGSGATAVVQAAYCVPRKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTS 81

  Fly   630 YLVSEELWVVMEYLPGGSLTDVVTET---------CMDEGQIAAVCREVLQALEFLHANQVIHRD 685
            ::|.:|||:||:.|.|||:.||:...         .:||..||.|.:||||.||:||.|..||||
Zfish    82 FVVKDELWLVMKLLSGGSVLDVIKHIISKGEHKTGVLDEPSIATVLKEVLQGLEYLHKNGQIHRD 146

  Fly   686 IKSDNILLGLDGSVKLTDFGFCAQIS-----PEQSKRTTMVGTPYWMAPEVVTR-KQYGPKVDLW 744
            :|:.|||||.||||::.|||..|.::     .....|.|.||||.||||||:.: |.|..|.|:|
Zfish   147 LKAGNILLGEDGSVQIADFGVSAFLATGGDMTRNKVRKTFVGTPCWMAPEVMEQVKGYDFKADIW 211

  Fly   745 SLGIMAIEMVEGEPPYLNENPLKALYLIATNGKP----EIKEKD---KLSSAFQDFLDQCLEVEV 802
            |.||.|||:..|..||....|:|.|.|...|..|    .|.:|:   |...:.:..:.|||:.|.
Zfish   212 SFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPCLETGITDKEMVKKYGKSLRKMISQCLQKEP 276

  Fly   803 DRRASALDLLKHPFLKLAR 821
            ::|.::.:||||.|.:.|:
Zfish   277 EKRPTSSELLKHKFFQKAK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 113/274 (41%)
S_TKc 566..817 CDD:214567 112/273 (41%)
oxsr1bNP_957469.2 STKc_OSR1_SPAK 15..291 CDD:270787 112/273 (41%)
S_TKc 17..291 CDD:214567 112/273 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.