DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and Taok2

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001157247.1 Gene:Taok2 / 381921 MGIID:1915919 Length:1240 Species:Mus musculus


Alignment Length:311 Identity:120/311 - (38%)
Similarity:173/311 - (55%) Gaps:20/311 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 ANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ 601
            |..:...:.|.::.|    :....||.:.::.:.:||.|:.|.||.|.:......||||:|:.|.
Mouse     3 AGGRAGSLKDPDVAE----LFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSG 63

  Fly   602 QPKKEL---IINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDV--VTETCMDEGQ 661
            :...|.   ||.|:..:::.:|||.:.|...||.....|:||||.. ||.:|:  |.:..:.|.:
Mouse    64 KQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCL-GSASDLLEVHKKPLQEVE 127

  Fly   662 IAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYW 726
            ||||....||.|.:||::.:||||:|:.||||...|.|||.|||..:.::|..|    .||||||
Mouse   128 IAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANS----FVGTPYW 188

  Fly   727 MAPEVV---TRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSS 788
            |||||:   ...||..|||:|||||..||:.|.:||..|.|.:.|||.||.|..|.: :....|.
Mouse   189 MAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPAL-QSGHWSE 252

  Fly   789 AFQDFLDQCLE-VEVDRRASALDLLKHPFLKLARPLASLTPLIMAAKEATK 838
            .|::|:|.||: :..||..|.: ||||.|:...||...:..||...|:|.:
Mouse   253 YFRNFVDSCLQKIPQDRPTSEV-LLKHRFVLRERPPTVIMDLIQRTKDAVR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 111/268 (41%)
S_TKc 566..817 CDD:214567 108/259 (42%)
Taok2NP_001157247.1 STKc_TAO2 12..319 CDD:270804 119/302 (39%)
S_TKc 28..281 CDD:214567 108/259 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..463
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 899..946
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1212..1240
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.