DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and Slik

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_726441.1 Gene:Slik / 37893 FlyBaseID:FBgn0035001 Length:1703 Species:Drosophila melanogaster


Alignment Length:298 Identity:105/298 - (35%)
Similarity:163/298 - (54%) Gaps:18/298 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 AKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQP 603
            ||||::.:.   .|:.|     ||...:..:.::|.||.|.||.|.........|.|...|..:.
  Fly    18 AKKKRLYNN---IKMDT-----DPAEFWEMVGELGDGAFGKVYKAQHKEQKRFAAAKMCQLEDEE 74

  Fly   604 KKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVT--ETCMDEGQIAAVC 666
            .....:.||.::.|.||||:|...:::.:.::||:::||..||:|..::.  |..:.|.|||.||
  Fly    75 NLSDHMVEIDILSEIKHPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVC 139

  Fly   667 REVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEV 731
            :.:.:.|.|||.|:|||||:|:.|:||.::|.|||.|||..|:......|..|.:|||||||||:
  Fly   140 KHMTEGLTFLHRNKVIHRDLKAGNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGTPYWMAPEL 204

  Fly   732 V-----TRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQ 791
            |     ....|..|||:|||||..||:.:.|||....:|::.|..|..:..|::::..:.|..|.
  Fly   205 VLCETFRDNPYDHKVDIWSLGITLIELAQMEPPNSEMSPMRVLLKIQKSEPPKLEQPSRWSKEFN 269

  Fly   792 DFLDQCLEVEVDRRASALDLLKHPFLKL---ARPLASL 826
            |||.:.|..:...|.:...|::|.|:..   |:|:..|
  Fly   270 DFLKKSLVKDPQVRPTTDVLMQHAFINRNLDAKPIKDL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 96/266 (36%)
S_TKc 566..817 CDD:214567 93/257 (36%)
SlikNP_726441.1 STKc_SLK_like 31..310 CDD:132942 100/282 (35%)
S_TKc 37..295 CDD:214567 93/257 (36%)
PKK 958..1095 CDD:289257
PKK 1126..1266 CDD:289257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.