DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and Stk25

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_908938.1 Gene:Stk25 / 373542 RGDID:727809 Length:426 Species:Rattus norvegicus


Alignment Length:272 Identity:115/272 - (42%)
Similarity:173/272 - (63%) Gaps:4/272 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 DPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ-QPKKELIINEILVMRENKHPNVV 624
            ||...:||:::||:|:.|.||..|::.|...||||.::|.: :.:.|.|..||.|:.:...|.:.
  Rat    15 DPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYIT 79

  Fly   625 NYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSD 689
            .|..|||.|.:||::||||.|||..|::....::|..||.:.||:|:.|::||:.:.||||||:.
  Rat    80 RYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAA 144

  Fly   690 NILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMV 754
            |:||...|.|||.|||...|::..|.||.|.||||:||||||:.:..|..|.|:|||||.|||:.
  Rat   145 NVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELA 209

  Fly   755 EGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-K 818
            :||||..:.:|::.|:||..|..|.::...  |..|::|::.||..:...|.:|.:||||.|: :
  Rat   210 KGEPPNSDLHPMRVLFLIPKNNPPTLEGHH--SKPFKEFVEACLNKDPRFRPTAKELLKHKFITR 272

  Fly   819 LARPLASLTPLI 830
            ..:..:.||.||
  Rat   273 YTKKTSFLTELI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 111/258 (43%)
S_TKc 566..817 CDD:214567 108/251 (43%)
Stk25NP_908938.1 STKc_STK25 15..291 CDD:270810 115/272 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.