DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and hppy

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster


Alignment Length:283 Identity:118/283 - (41%)
Similarity:170/283 - (60%) Gaps:12/283 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   553 LRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRE 617
            |.:.:|..:|..:|..::|||.|..|.||.|....:....|||.:.|......::|..||::||:
  Fly    13 LSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRD 77

  Fly   618 NKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQV 681
            .:|||::.|..|||..::||:.||:..||||.|:...| .:.|.|||.:|||.|:.||:||:...
  Fly    78 CRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGK 142

  Fly   682 IHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEV--VTRK-QYGPKVDL 743
            :|||||..||||...|.|||.|||..|||:...:||.:.:||||||||||  |.|| .|....|:
  Fly   143 MHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDI 207

  Fly   744 WSLGIMAIEMVEGEPPYLNENPLKALYLIATNG--KPEIKEKDKLSSAFQDFLDQCLEVEVDRRA 806
            |:.||.|||:.|.:||..:.:|::||:|::.:|  .|.:..|||.|..|.:|:...|.....:|.
  Fly   208 WACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRP 272

  Fly   807 SALDLLKHPF------LKLARPL 823
            :|..||:|||      |::|:.|
  Fly   273 TAERLLQHPFVQCEMSLRVAKEL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 114/271 (42%)
S_TKc 566..817 CDD:214567 112/262 (43%)
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 111/257 (43%)
S_TKc 26..283 CDD:214567 111/256 (43%)
CNH 869..1184 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.