DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and Stlk

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster


Alignment Length:305 Identity:80/305 - (26%)
Similarity:143/305 - (46%) Gaps:45/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKK-ELIINEILVMRENKHPNVVNYLDS 629
            |..:|.:..|..||||.| |......:|:|::::.|..:| .|:.||:|.:|..:|.|:...:..
  Fly    10 YKLLEILKNGMIGTVYKA-EDINNKCLAVKKVSMDQPMEKLTLLFNEVLTVRRLQHRNINTIVSC 73

  Fly   630 YLVSEELWVVMEYLPGGS----LTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDN 690
            :|..:.:::..:::..|:    |.:|.| :...|..||.:.::||.||.::|:...:|..:::.:
  Fly    74 FLYKQYVYLTYKFMCFGNCEVLLKNVYT-SGFPEVAIALILKDVLSALTYIHSEHYVHGSVRAKH 137

  Fly   691 ILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTP-------YWMAPEVVTR--KQYGPKVDLWSL 746
            |||....:| |::|.:|.....:..|:|.:.|:.       ||.||||:.:  ..|..|:|::|:
  Fly   138 ILLSPRKAV-LSNFSYCQSFISQGEKKTFIFGSTVGIEKELYWTAPEVLYQNLSGYTEKIDIYSI 201

  Fly   747 GIMAIEMVEGEPPYLNENPLKALY----------------LIATNGKPEIKEKDK---------- 785
            ||...||..|..|: .:..|..:|                |:...|...::..:|          
  Fly   202 GITCCEMANGFQPF-KDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLSLEHTNKRIARDVIVNK 265

  Fly   786 -LSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPL 829
             .|..|..|::.||......|.:|..|:.|.|||..|..:.|..|
  Fly   266 SFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQCRNTSLLDQL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 75/292 (26%)
S_TKc 566..817 CDD:214567 74/291 (25%)
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 80/305 (26%)
S_TKc 10..298 CDD:214567 74/291 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.