DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and map4k5

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:XP_021336201.1 Gene:map4k5 / 334565 ZFINID:ZDB-GENE-030131-6497 Length:894 Species:Danio rerio


Alignment Length:273 Identity:112/273 - (41%)
Similarity:164/273 - (60%) Gaps:9/273 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 DPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVN 625
            :|...:..::::|.|..|.||.|.:.|||...|:|.:.|.......:|..||.:::|..|.|:|.
Zfish    15 NPQHDFELIQRVGSGTYGDVYKARKISTGELAAVKIIKLEPGDDFSIIQQEIFMVKECTHHNIVA 79

  Fly   626 YLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSD 689
            |..|||..|:||:.|||..||||.|:...| .:.|.|||.||||.||.|.:||:...:|||||..
Zfish    80 YFGSYLCREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLGYLHSKGKMHRDIKGA 144

  Fly   690 NILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQ---YGPKVDLWSLGIMAI 751
            ||||..:|.|||.|||..|:|:...:||.:.:||||||||||...::   |....|:|::||.:|
Zfish   145 NILLTDNGDVKLADFGVAAKITATMAKRKSFIGTPYWMAPEVAAVEKNGGYNHLCDIWAVGITSI 209

  Fly   752 EMVEGEPPYLNENPLKALYLIATNG--KPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKH 814
            |:.|.:||..:.:|::||:|::.:.  .|::|:|.|.|:||.:|:...|.....||.:|..:|.|
Zfish   210 ELAELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSTAFHNFVKLSLTKNPKRRPTAEKMLSH 274

  Fly   815 PFL---KLARPLA 824
            .|:   .|.|.||
Zfish   275 LFVGQTGLTRRLA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 108/265 (41%)
S_TKc 566..817 CDD:214567 106/256 (41%)
map4k5XP_021336201.1 STKc_MAP4K5 10..277 CDD:270813 107/261 (41%)
CNH 559..874 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.