DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and STK39

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_037365.2 Gene:STK39 / 27347 HGNCID:17717 Length:545 Species:Homo sapiens


Alignment Length:387 Identity:135/387 - (34%)
Similarity:193/387 - (49%) Gaps:60/387 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 SPTPASIESPDLYTPEPTVAQVSAGGPSSQVAGNQIAVPQAAVAPAATPNTRAANAKKKKMSDEE 548
            |.:|..::.|....|   |...:|..|::..|....|.| ||.|||..|..:|            
Human     5 SGSPVHVQLPQQAAP---VTAAAAAAPAAATAAPAPAAP-AAPAPAPAPAAQA------------ 53

  Fly   549 ILEKLRTIVSVGDP--NRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ-QPKKELIIN 610
                      ||.|  ...|...|.||.||:..|..|:.......||||::||.: |...:.::.
Human    54 ----------VGWPICRDAYELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLK 108

  Fly   611 EILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVV---------TETCMDEGQIAAVC 666
            ||..|.:..|||||.|..|::|.:|||:||:.|.|||:.|::         ....::|..||.:.
Human   109 EIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATIL 173

  Fly   667 REVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQIS-----PEQSKRTTMVGTPYW 726
            :|||:.|::||.|..||||:|:.|||||.||||::.|||..|.::     .....|.|.||||.|
Human   174 KEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKVRKTFVGTPCW 238

  Fly   727 MAPEVVTR-KQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPE----IKEKD-- 784
            |||||:.: :.|..|.|:||.||.|||:..|..||....|:|.|.|...|..|.    :::|:  
Human   239 MAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMM 303

  Fly   785 -KLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLAR-------PLASLTPLIMAAKEATK 838
             |...:|:..|..||:.:..:|.:|.:|||..|.:.|:       .|.:.||.|  |:.|.|
Human   304 KKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDI--AQRAKK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 110/284 (39%)
S_TKc 566..817 CDD:214567 106/273 (39%)
STK39NP_037365.2 STKc_OSR1_SPAK 61..337 CDD:270787 106/275 (39%)
S_TKc 63..337 CDD:214567 106/273 (39%)
Interaction with RELT. /evidence=ECO:0000250|UniProtKB:Q9Z1W9 310..536 18/56 (32%)
Nuclear localization signal. /evidence=ECO:0000255 360..366 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..423 2/3 (67%)
Caspase cleavage related site 387..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.