DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and sid1

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_593564.1 Gene:sid1 / 2542746 PomBaseID:SPAC9G1.09 Length:471 Species:Schizosaccharomyces pombe


Alignment Length:268 Identity:107/268 - (39%)
Similarity:162/268 - (60%) Gaps:4/268 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMREN-KHPNVVNYLDS 629
            ||.:.|:|.|:.|.|:.|.|:.:|..:||||::|.........|.:.:.|..| ...||:.|...
pombe     9 YTLLRKLGSGSFGVVWKARENVSGDIIAIKQIDLETGIDDITDIEQEVFMLSNCNSSNVIQYYGC 73

  Fly   630 YLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLG 694
            ::....||::||::.|||::.::....::|..|:.:.||||..|.:||....||||||:.||||.
pombe    74 FVDGYTLWILMEHMDGGSVSGLLKMGRLNEQVISIILREVLYGLNYLHGQNKIHRDIKAANILLS 138

  Fly   695 LD-GSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEP 758
            .. |:|||.|||..||:|...|:|.|.||||:||||||:.:..||...|:|||||.||||..|.|
pombe   139 SSTGNVKLADFGVAAQLSNAASRRHTFVGTPFWMAPEVIQQTSYGLAADIWSLGITAIEMANGIP 203

  Fly   759 PYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPL 823
            |....:|::.::.|..:..|::  .|..|..|:||:..||::..:.|.||.:||:|||:|.|..:
pombe   204 PRATMHPMRVIFEIPQSEPPKL--DDHFSPTFRDFVSCCLDLNPNMRWSAKELLQHPFIKSAGTV 266

  Fly   824 ASLTPLIM 831
            ..:.||::
pombe   267 KDIIPLLV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 103/253 (41%)
S_TKc 566..817 CDD:214567 102/252 (40%)
sid1NP_593564.1 STKc_MST3_like 7..279 CDD:270786 107/268 (40%)
S_TKc 9..260 CDD:214567 102/252 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.