DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and cdc7

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_596340.1 Gene:cdc7 / 2540660 PomBaseID:SPBC21.06c Length:1062 Species:Schizosaccharomyces pombe


Alignment Length:253 Identity:95/253 - (37%)
Similarity:144/253 - (56%) Gaps:15/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 IGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKEL--IINEILVMRENKHPNVVNYLDSYLVSE 634
            :|:||.|.||..:....|..||:|::.||:..|.:|  |..||.:::...|||:|.|..||..::
pombe    15 LGKGAFGAVYRGLNIKNGETVAVKKVKLSKMLKSDLSVIKMEIDLLKNLDHPNIVKYRGSYQTND 79

  Fly   635 ELWVVMEYLPGGSLTDVVTETCMDEGQI-----AAVCREVLQALEFLHANQVIHRDIKSDNILLG 694
            .|.:::||...|||..:    |.:.|:|     |....:|||.|.:||...|||||||..|||..
pombe    80 SLCIILEYCENGSLRSI----CKNFGKIPENLVALYTFQVLQGLLYLHNQGVIHRDIKGANILTT 140

  Fly   695 LDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPP 759
            .||::||.|||...:|:..:..  ::||:||||||||:.........|:||:|...||:::|.||
pombe   141 KDGTIKLADFGVATKINALEDH--SVVGSPYWMAPEVIELVGATTASDIWSVGCTVIELLDGNPP 203

  Fly   760 YLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 817
            |.:.:|..||:.:..:..|.:  ...:|||.:.||.||.:.:.:.|.....|||||::
pombe   204 YYDLDPTSALFRMVKDEHPPL--PSNISSAAKSFLMQCFQKDPNLRIKTRKLLKHPWV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 95/253 (38%)
S_TKc 566..817 CDD:214567 95/251 (38%)
cdc7NP_596340.1 STKc_Cdc7_like 10..259 CDD:270797 95/251 (38%)
S_TKc 10..259 CDD:214567 95/251 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.