DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and Oxsr1

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001346511.1 Gene:Oxsr1 / 108737 MGIID:1917378 Length:527 Species:Mus musculus


Alignment Length:279 Identity:109/279 - (39%)
Similarity:160/279 - (57%) Gaps:23/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ-QPKKELIINEILVMRENKHPNVVNYLDS 629
            |...|.||.||:..|..|..:.....||||::||.: |...:.::.||..|.:..|||:|:|..|
Mouse    17 YELQEVIGSGATAVVQAAYCAPKKERVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTS 81

  Fly   630 YLVSEELWVVMEYLPGGSLTDVVTET---------CMDEGQIAAVCREVLQALEFLHANQVIHRD 685
            ::|.:|||:||:.|.|||:.|::...         .:||..||.:.||||:.||:||.|..||||
Mouse    82 FVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDEPTIATILREVLEGLEYLHKNGQIHRD 146

  Fly   686 IKSDNILLGLDGSVKLTDFGFCAQIS-----PEQSKRTTMVGTPYWMAPEVVTR-KQYGPKVDLW 744
            :|:.|||||.||||::.|||..|.::     .....|.|.||||.||||||:.: :.|..|.|:|
Mouse   147 VKAGNILLGEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIW 211

  Fly   745 SLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPE----IKEKD---KLSSAFQDFLDQCLEVEV 802
            |.||.|||:..|..||....|:|.|.|...|..|.    :::|:   |...:|:..:..||:.:.
Mouse   212 SFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDP 276

  Fly   803 DRRASALDLLKHPFLKLAR 821
            ::|.:|.:||:|.|.:.|:
Mouse   277 EKRPTAAELLRHKFFQKAK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 108/274 (39%)
S_TKc 566..817 CDD:214567 107/273 (39%)
Oxsr1NP_001346511.1 STKc_OSR1_SPAK 15..291 CDD:270787 107/273 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..356
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.