DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and pak5

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001120110.1 Gene:pak5 / 100145129 XenbaseID:XB-GENE-960008 Length:349 Species:Xenopus tropicalis


Alignment Length:375 Identity:73/375 - (19%)
Similarity:121/375 - (32%) Gaps:115/375 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RKKKTLKSKIKGSKPSHTDSKPNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQE 124
            :|||.|                :||.|:||||.||.|||....:|.|:|:.|..||.:: .::.:
 Frog     4 KKKKKL----------------DISGPSNFEHRVHTGFDHKEQKFIGLPQQWQSLLADT-ANRPK 51

  Fly   125 QKKNPQAVLDV----LKWFDNTTKQRPSSKYMTNAITTHSGSSLSRVSSSSPSSTPTDSELHGSN 185
            ...:|..:..:    :|.....:|. |...|:...:......|::|.:|....|.||....|.::
 Frog    52 PMVDPSCITPIQLAPMKTIVRGSKP-PQDTYINGLLEDFDNISVTRSNSLRKESPPTPRLGHSNH 115

  Fly   186 SGGNLIGVQLGSMTLGPNANNVAVAGQI----------LGNHYQQQQQHLLQQQQPLLHQ----- 235
            ..|.            |..|......|.          :...|:::.  |..::..:.::     
 Frog   116 LKGY------------PEENGFFAFSQYSCEPEVQRSNISERYKERS--LSAEEAEVYYRANKPV 166

  Fly   236 NHNQHHMGISQSHSYNFVGHTVSSSTSQHSSANEDDMLGPQHPQQQPP----------------- 283
            .||.|.:.:....:|.....:|.:..|.:.|        ..|||.:..                 
 Frog   167 RHNGHPVKMRSYETYFPEVKSVRADLSSYPS--------EYHPQLETKSKSVDQYDYHSIAGTSL 223

  Fly   284 -------PPPVA-----SRPERTKSIYTR-----PIEDLQPAIIPMPVAPATTPATP----LQNH 327
                   ||.:.     |...|.:..|:.     |.:|..    ..|.:...|..:|    .|..
 Frog   224 QDYRDYFPPSITGTIMLSEGSRERLEYSEWGEGLPKDDYD----KRPKSSYITQTSPQPAMRQRS 284

  Fly   328 RTPGGISAP----AASPMMHNNATTTLDKNKNNATPTSPTTTKTTAETEG 373
            |:..|:..|    .|..|          |......|.|..|....:||.|
 Frog   285 RSGSGLQEPIIPYGAGVM----------KTNQQGHPFSSYTYPRLSETGG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166 19/57 (33%)
STKc_PAK_I 558..818 CDD:270814
S_TKc 566..817 CDD:214567
pak5NP_001120110.1 CRIB_PAK_like 11..55 CDD:238526 18/44 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D757766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.