DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and STK24

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:XP_016876283.1 Gene:STK24 / 8428 HGNCID:11403 Length:517 Species:Homo sapiens


Alignment Length:354 Identity:149/354 - (42%)
Similarity:217/354 - (61%) Gaps:40/354 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDV--TEDEEEEIKLEINVLKKYSNHRNI 89
            ||..:|..:|.:|.|::|:|:||...:|.::.|||::|:  .|||.|:|:.||.||.: .:...:
Human   105 DPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQ-CDSPYV 168

  Fly    90 ATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSN 154
            ..|||:::      ||.:||::|||.|.||..||::.   ..|.|..||.|.||||:||.||||.
Human   169 TKYYGSYL------KDTKLWIIMEYLGGGSALDLLEP---GPLDETQIATILREILKGLDYLHSE 224

  Fly   155 KVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDN 219
            |.||||||..||||:::.||||.||||:.||..|..:||||:|||:|||||||     ..:.||:
Human   225 KKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI-----KQSAYDS 284

  Fly   220 RSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQR 284
            ::|:|||||||:|:|..:||..:||||:.|||||:|:||.|:. .:||....|::..|.|:...|
Human   285 KADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEG-NYSKPLKEFVEACLNKEPSFR 348

  Fly   285 PYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLAGEHSSI 349
            |..:.||||.||.   .:.:....|.:.|||.|:.|.|:..:|     |.::|.:.:..|     
Human   349 PTAKELLKHKFIL---RNAKKTSYLTELIDRYKRWKAEQSHDD-----SSSEDSDAETDG----- 400

  Fly   350 VQAPGGD-------TLR-RNFQQIQEGRL 370
             ||.||.       |:| ::.:.::.|.|
Human   401 -QASGGSDSGDWIFTIREKDPKNLENGAL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 128/270 (47%)
S_TKc 32..296 CDD:214567 126/265 (48%)
CNH 1183..1484 CDD:214481
STK24XP_016876283.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.