DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and AT4G14480

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_193184.1 Gene:AT4G14480 / 827095 AraportID:AT4G14480 Length:487 Species:Arabidopsis thaliana


Alignment Length:375 Identity:113/375 - (30%)
Similarity:173/375 - (46%) Gaps:61/375 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AGIFELIEVVGNGTYGQVYKG-RHTKTGQLAAIKVMDVTED--EEEEIKLEINVLKKYSNHRNIA 90
            |..:|:|..:|.|....|||. .......:.|||.:|:.:.  :.:.::.|...:...| |.||.
plant    12 AEAYEIICKIGVGVSASVYKAICIPMNSMVVAIKAIDLDQSRADFDSLRRETKTMSLLS-HPNIL 75

  Fly    91 TYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNK 155
            ..|.:|.      .|..||:||.:...||:..:|.|:....|.|..|:...:|.|..:||||...
plant    76 NAYCSFT------VDRCLWVVMPFMSCGSLHSIVSSSFPSGLPENCISVFLKETLNAISYLHDQG 134

  Fly   156 VIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIG----------RRNTFIGTPYWMAPEVIACD 210
            .:|||||..|:|:..:..|||.||||||.:...:.          |.....||||||||||:   
plant   135 HLHRDIKAGNILVDSDGSVKLADFGVSASIYEPVTSSSGTTSSSLRLTDIAGTPYWMAPEVV--- 196

  Fly   211 ENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFL------------IPRNSPPRLKSK 263
             :....|..::|:||.||||||:|..:|||..|.|:::|.:            |..:...:..:|
plant   197 -HSHTGYGFKADIWSFGITALELAHGRPPLSHLPPLKSLLMKITKRFHFSDYEINTSGSSKKGNK 260

  Fly   264 KWSKKFHGFIDTVLVKDYHQRPYTENLLKHGFIKD------------------QPTDRQVRIQLK 310
            |:||.|...:...|.:|..:||..|.||||.|.|:                  :....:.:|.:|
plant   261 KFSKAFREMVGLCLEQDPTKRPSAEKLLKHPFFKNCKGLDFVVKNVLHSLSNAEQMFMESQILIK 325

  Fly   311 DHIDRCKKRKQEKER--EDYRYSGSDNDDDEPQL-----AGEHSSIVQAP 353
            ...|..::.::|.|.  ::.|.||.:..:|:.||     |.|..|...:|
plant   326 SVGDDDEEEEEEDEEIVKNRRISGWNFREDDLQLSPVFPATESDSSESSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 96/291 (33%)
S_TKc 32..296 CDD:214567 95/288 (33%)
CNH 1183..1484 CDD:214481
AT4G14480NP_193184.1 STKc_OSR1_SPAK 13..293 CDD:270787 95/290 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.