DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and stk24a

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_001103921.1 Gene:stk24a / 555297 ZFINID:ZDB-GENE-070424-52 Length:415 Species:Danio rerio


Alignment Length:326 Identity:149/326 - (45%)
Similarity:207/326 - (63%) Gaps:34/326 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDV--TEDEEEEIKLEINVLKKYSNHRNI 89
            ||..:|..:|.:|.|::|:|:||...:|.::.|||::|:  .|||.|:|:.||.||.: .:...|
Zfish    12 DPEKLFTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEVEDIQQEITVLSQ-CDSLFI 75

  Fly    90 ATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSN 154
            ..|:|:::      ||.:||::|||.|.||..||:..   .:|.|..||.|.||||:||.||||.
Zfish    76 TKYFGSYL------KDTKLWIIMEYLGGGSALDLLGP---GALDETHIATILREILKGLDYLHSE 131

  Fly   155 KVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDN 219
            |.||||||..||||::..:|||.||||:.||..|..:||||:|||:|||||||...|     ||:
Zfish   132 KKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSE-----YDS 191

  Fly   220 RSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQR 284
            ::|:|||||||:|:|:.:||..|||||:.|||||:.:||.|:. .::|....|:|..|.||.:.|
Zfish   192 KADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKENPPTLEG-NYNKALKEFVDACLNKDPNFR 255

  Fly   285 PYTENLLKHGFIKDQPTDRQVRIQ-----LKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLAG 344
            |..:.||||..|        ||..     |.|.||:.||.|.::.||:   |.||:|.||.:.:|
Zfish   256 PTAKELLKHKLI--------VRYSKKTSYLMDLIDKYKKWKLKQAREE---SSSDSDSDEEEASG 309

  Fly   345 E 345
            |
Zfish   310 E 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 129/270 (48%)
S_TKc 32..296 CDD:214567 127/265 (48%)
CNH 1183..1484 CDD:214481
stk24aNP_001103921.1 STKc_MST3_like 15..288 CDD:270786 136/296 (46%)
S_TKc 17..267 CDD:214567 127/265 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.