DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and MYO3A

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_059129.3 Gene:MYO3A / 53904 HGNCID:7601 Length:1616 Species:Homo sapiens


Alignment Length:306 Identity:157/306 - (51%)
Similarity:204/306 - (66%) Gaps:7/306 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIAT 91
            ||:..:|:.|.:|.||||:|:|..:.|.||.||:|::|...|.:|||:.|.|:||..|:|.|:..
Human    16 DPSDTWEITETIGKGTYGKVFKVLNKKNGQKAAVKILDPIHDIDEEIEAEYNILKALSDHPNVVR 80

  Fly    92 YYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKS--TKGQSLKEEWIAYICREILRGLSYLHSN 154
            :||.:.||... ..|:||||:|.|..||||||||.  .:|:.:.|..||||..|.|.||.:||:|
Human    81 FYGIYFKKDKV-NGDKLWLVLELCSGGSVTDLVKGFLKRGERMSEPLIAYILHEALMGLQHLHNN 144

  Fly   155 KVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDN 219
            |.||||:||.|:|||....||||||||||||..|..||||.:|||:|||||||||::..|.|||.
Human   145 KTIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRHRRNTSVGTPFWMAPEVIACEQQLDTTYDA 209

  Fly   220 RSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKK-WSKKFHGFIDTVLVKDYHQ 283
            |.|.|||||||:|:.:..|||.|||||||||.||||.||:|:..: ||.:|:.||...|.|||.:
Human   210 RCDTWSLGITAIELGDGDPPLADLHPMRALFKIPRNPPPKLRQPELWSAEFNDFISKCLTKDYEK 274

  Fly   284 RPYTENLLKHGFIKD-QPTDRQVRIQLKDH--IDRCKKRKQEKERE 326
            ||....||:|.||.. :..|..::.||.:.  |.:|....::..||
Human   275 RPTVSELLQHKFITQIEGKDVMLQKQLTEFIGIHQCMGGTEKARRE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 148/271 (55%)
S_TKc 32..296 CDD:214567 146/266 (55%)
CNH 1183..1484 CDD:214481
MYO3ANP_059129.3 STKc_myosinIIIA_N 2..287 CDD:132969 148/271 (55%)
S_TKc 21..287 CDD:214567 146/266 (55%)
MYSc 337..1053 CDD:214580
MYSc_Myo3 352..1041 CDD:276830
Actin-binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU00782 934..956
Interaction with MORN4. /evidence=ECO:0000269|PubMed:25822849 1401..1479
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1545..1567
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1581..1616
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.