DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and Myo3a

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:XP_574090.6 Gene:Myo3a / 498806 RGDID:1560083 Length:268 Species:Rattus norvegicus


Alignment Length:240 Identity:128/240 - (53%)
Similarity:168/240 - (70%) Gaps:3/240 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIAT 91
            ||:..:|:.|.:|.||||:|:|..:.|.||.||:|::|...|.:|||:.|.|:|:..|:|.|:..
  Rat    16 DPSDTWEITETIGKGTYGKVFKVLNKKNGQKAAVKILDPIHDIDEEIEAEYNILRTLSDHPNVVR 80

  Fly    92 YYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKS--TKGQSLKEEWIAYICREILRGLSYLHSN 154
            :||.:.||... ..|:||||:|.|..||||||||.  .:|:.:.|..||||..|.|.||.:||||
  Rat    81 FYGIYFKKDKI-NGDKLWLVLELCNGGSVTDLVKGFLKRGERMSEPIIAYILHEALMGLQHLHSN 144

  Fly   155 KVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDN 219
            |.||||:||.|:|||....||||||||||||..|..|.||.:|||:|||||||||::..|.|||.
  Rat   145 KTIHRDVKGNNILLTTEGGVKLVDFGVSAQLSSTRHRLNTSVGTPFWMAPEVIACEQQLDTTYDA 209

  Fly   220 RSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKK 264
            |.|.|||||||:|:.:..|||.:||||||||.|||:...:::.::
  Rat   210 RCDTWSLGITAIELGDGDPPLAELHPMRALFKIPRSGDQQVQDQQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 128/240 (53%)
S_TKc 32..296 CDD:214567 126/235 (54%)
CNH 1183..1484 CDD:214481
Myo3aXP_574090.6 PKc_like 2..258 CDD:419665 128/240 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.