DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and fray

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_001303449.2 Gene:fray / 44233 FlyBaseID:FBgn0023083 Length:707 Species:Drosophila melanogaster


Alignment Length:457 Identity:132/457 - (28%)
Similarity:192/457 - (42%) Gaps:116/457 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTE--DEEEEIKLEINVLKKYSNHRNIATYYG 94
            :||.:|:|.|....|:........:..|||.:::.:  ...:|:..||..:.. ..|.|:.||:.
  Fly   193 YELRDVIGVGATAVVHGAYCIPRNEKCAIKRINLEKWNTSMDELLKEIQAMSS-CFHENVVTYHT 256

  Fly    95 AFIKKSPPGKDDQLWLVMEYCGAGSVTDLVK------STKGQSLKEEWIAYICREILRGLSYLHS 153
            :|:.:      ::||||:.....||:.|::|      :.|.....|..||.:.:|:|:||.|.||
  Fly   257 SFVVR------EELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHS 315

  Fly   154 NKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQL--DRTIGR---RNTFIGTPYWMAPEVIACDENP 213
            |..||||||..|:|:.|:..:::.||||||.|  .|.:.|   |:||:|||.||||||:..|.. 
  Fly   316 NGQIHRDIKAGNILIGDDGTIQIADFGVSAWLATGRDLSRQKVRHTFVGTPCWMAPEVMEQDHG- 379

  Fly   214 DATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKS--------KKWSKKFH 270
               ||.::|:||.||||:|||....|.....||:.|.|..:|.||.|.:        |.:.|.|.
  Fly   380 ---YDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTFR 441

  Fly   271 GFIDTVLVKDYHQRPYTENLLKHGFIKDQPTDRQVRIQ--------LKDHIDRCKKRKQ------ 321
            ..|...|.|:..:||....||||.|.| :..||:...|        ::..:.:..||:.      
  Fly   442 KMIVECLQKEPSKRPTASELLKHAFFK-KAKDRKYLTQTLLQSGPSMETRVHKAAKRQPGASGRL 505

  Fly   322 ----------EKERED------------------------------YRYSGSDNDDDE--PQLAG 344
                      ..|.||                              .|...||:|.:|  |::..
  Fly   506 HRTVTGEWVWSSEEEDNGGSATGSGTGDRKHPSSDSDSEDRPMNRLERADSSDSDREEPSPEITH 570

  Fly   345 EHSSIVQAPGGDTLRRNFQQIQEGRLAAEQQQQHHLMAQAQAQAAAAHAAAQAQAQLQQQQQQAA 409
            ..||....||                           |.|.|.|.||.......|||....:.|.
  Fly   571 SVSSATVTPG---------------------------APAAAGAGAAQELTAGIAQLPLPSEAAG 608

  Fly   410 AA 411
            .|
  Fly   609 EA 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 101/284 (36%)
S_TKc 32..296 CDD:214567 101/284 (36%)
CNH 1183..1484 CDD:214481
frayNP_001303449.2 STKc_OSR1_SPAK 191..467 CDD:270787 101/284 (36%)
OSR1_C 613..670 CDD:403428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.