DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and Pak

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:277 Identity:107/277 - (38%)
Similarity:163/277 - (58%) Gaps:15/277 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LTALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNH 86
            :.::.||...:..:|.:|.|..|.||....:.||...|||.|::::..::|:.:...::.:.:.|
  Fly   556 IVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKH 620

  Fly    87 RNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYL 151
            .|:..|..:::      ..::||:||||...||:||:|..|   .:.|..||.:|||:|:.|.:|
  Fly   621 PNVVNYLDSYL------VSEELWVVMEYLPGGSLTDVVTET---CMDEGQIAAVCREVLQALEFL 676

  Fly   152 HSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDAT 216
            |:|:|||||||..|:||..:..|||.|||..||:.....:|.|.:||||||||||:...:     
  Fly   677 HANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQ----- 736

  Fly   217 YDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSK-KWSKKFHGFIDTVLVKD 280
            |..:.|||||||.|:||.|.:||..:.:|::||:||..|..|.:|.| |.|..|..|:|..|..:
  Fly   737 YGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVE 801

  Fly   281 YHQRPYTENLLKHGFIK 297
            ..:|....:||||.|:|
  Fly   802 VDRRASALDLLKHPFLK 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 105/271 (39%)
S_TKc 32..296 CDD:214567 103/264 (39%)
CNH 1183..1484 CDD:214481
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 106/273 (39%)
S_TKc 566..817 CDD:214567 103/264 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.