DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and myo3a

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_991142.2 Gene:myo3a / 402814 ZFINID:ZDB-GENE-041026-4 Length:1775 Species:Danio rerio


Alignment Length:343 Identity:161/343 - (46%)
Similarity:210/343 - (61%) Gaps:28/343 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIAT 91
            ||:..:|:||.:|.||||:|||..:...|..||:|::|...|.:|||:.|.|:||..|:|.|:..
Zfish    16 DPSDTWEIIETIGKGTYGKVYKVHNKVDGSKAAVKILDPIHDIDEEIEAEYNILKALSDHPNVVK 80

  Fly    92 YYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKS--TKGQSLKEEWIAYICREILRGLSYLHSN 154
            ::|.|.||... ..||||||:|.|..||||||.|.  .:|..::|..||:|..|.|.||.:||.|
Zfish    81 FFGMFYKKDVK-TGDQLWLVLELCNGGSVTDLAKGMLKRGDRMEEPIIAFILHEALMGLQHLHVN 144

  Fly   155 KVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDN 219
            |.||||:||.|:|||.:..:|||||||||||..|..||||.:|||:|||||||||::..|:|||.
Zfish   145 KTIHRDVKGNNILLTTDGGIKLVDFGVSAQLTNTRLRRNTSVGTPFWMAPEVIACEQQLDSTYDE 209

  Fly   220 RSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRL-KSKKWSKKFHGFIDTVLVKDYHQ 283
            |.|:|||||||:|:.:..|||.:||||||||.||||.||.| :.:.||..|:.||...|:||:..
Zfish   210 RCDVWSLGITAIELGDGDPPLAELHPMRALFKIPRNPPPTLHQPELWSNDFNDFIRKCLIKDFEL 274

  Fly   284 RPYTENLLKHGFIKDQPTDRQVRIQ--------------------LKDHIDRCKKRKQEK---ER 325
            ||...:||:|.||| |...|:..:|                    |....||....:.|:   ::
Zfish   275 RPNVLDLLQHVFIK-QIVGREKTLQKQLMELIDLNQQMGIIEKTSLLGKSDRDSDSRHERIHTKK 338

  Fly   326 EDYRYSGSDNDDDEPQLA 343
            ..|..|.|...||...||
Zfish   339 NSYMKSQSQTCDDADDLA 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 144/271 (53%)
S_TKc 32..296 CDD:214567 142/266 (53%)
CNH 1183..1484 CDD:214481
myo3aNP_991142.2 PKc_like 2..287 CDD:328722 144/271 (53%)
MYSc_Myo3 364..1091 CDD:276830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.