DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and stk4

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_989249.1 Gene:stk4 / 394860 XenbaseID:XB-GENE-955920 Length:485 Species:Xenopus tropicalis


Alignment Length:344 Identity:142/344 - (41%)
Similarity:206/344 - (59%) Gaps:20/344 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIA 90
            |.|..:|:::|.:|.|:||.|||..|.:|.|:.|||.:.|..|.:|.|| ||.:::: .:..::.
 Frog    24 KQPEEVFDVLEKLGEGSYGSVYKASHKETSQIVAIKQIPVESDLQEIIK-EIAIMQQ-CDSLHVV 86

  Fly    91 TYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNK 155
            .|||::.|.:      .||:|||:||.||::|:::..| |:|||:..|.|.:..|:||.|||..:
 Frog    87 KYYGSYFKNT------DLWIVMEFCGGGSISDIIRLRK-QTLKEDETATILQSTLKGLEYLHFMR 144

  Fly   156 VIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNR 220
            .||||||..|:||......||.||||:.||..|:.:|||.||||:|||||||     .:..|:..
 Frog   145 KIHRDIKAGNILLNSEGTAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI-----QEIGYNCV 204

  Fly   221 SDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRL-KSKKWSKKFHGFIDTVLVKDYHQR 284
            :|:|||||||:||||.:||..::|||||:|:||.|.||.. |.:.|||.|..||:..|||:...|
 Frog   205 ADIWSLGITAIEMAEGKPPYAEIHPMRAIFMIPSNPPPTFRKPELWSKDFVDFINLCLVKNPELR 269

  Fly   285 PYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLAGEHSSI 349
            .....||:|.|||....:..:|..:.:..|...||.:.|:||.......:.|:||..:    .::
 Frog   270 SSATELLQHPFIKTAKGESILRHLINEAQDAKLKRTELKQREVEPEEEENADEDEADV----GTM 330

  Fly   350 VQAPGGD-TLRRNFQQIQE 367
            |||...| ...:.|..:.|
 Frog   331 VQAGSKDLNTMKEFSTMNE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 123/270 (46%)
S_TKc 32..296 CDD:214567 121/264 (46%)
CNH 1183..1484 CDD:214481
stk4NP_989249.1 STKc_MST1_2 26..281 CDD:132943 122/268 (46%)
Mst1_SARAH 431..478 CDD:314497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.