DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and Stk25

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_908938.1 Gene:Stk25 / 373542 RGDID:727809 Length:426 Species:Rattus norvegicus


Alignment Length:412 Identity:161/412 - (39%)
Similarity:237/412 - (57%) Gaps:32/412 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDV--TEDEEEEIKLEINVLKKYSNHRNI 89
            ||..:|..::.:|.|::|:||||....|.::.|||::|:  .|||.|:|:.||.||.: .:...|
  Rat    15 DPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQ-CDSPYI 78

  Fly    90 ATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSN 154
            ..|:|:::|.:      :||::|||.|.||..||:|.   ..|:|.:||.|.||||:||.||||.
  Rat    79 TRYFGSYLKST------KLWIIMEYLGGGSALDLLKP---GPLEETYIATILREILKGLDYLHSE 134

  Fly   155 KVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDN 219
            :.||||||..||||::..:|||.||||:.||..|..:||||:|||:|||||||     ..:.||.
  Rat   135 RKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI-----KQSAYDF 194

  Fly   220 RSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQR 284
            ::|:|||||||:|:|:.:||..||||||.|||||:|:||.|:... ||.|..|::..|.||...|
  Rat   195 KADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPTLEGHH-SKPFKEFVEACLNKDPRFR 258

  Fly   285 PYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLAGEHSSI 349
            |..:.||||.||...........:|   |||.|:.|.|...|:  .|..|:|.|.....||...|
  Rat   259 PTAKELLKHKFITRYTKKTSFLTEL---IDRYKRWKSEGHGEE--SSSEDSDIDGEAEDGEQGPI 318

  Fly   350 VQAPGGDTLRRN-FQQIQEG-RLAAEQQQQHHLMAQAQAQAAAAHAAAQAQAQLQQQQQQAAAAA 412
            ...|  .|:|.: ..::.:| .|.:.|:....:..|.::|..:. .......:|:::.:|:..:.
  Rat   319 WTFP--PTIRPSPHSKLHKGTALHSSQKPAEPIKRQPRSQCLST-LVRPVFGELKEKHKQSGGSV 380

  Fly   413 AAAAHAAQQAQQAAQQAQAQQP 434
            .    |.::.:.|...|:...|
  Rat   381 G----ALEELENAFSLAEESCP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 130/270 (48%)
S_TKc 32..296 CDD:214567 128/265 (48%)
CNH 1183..1484 CDD:214481
Stk25NP_908938.1 STKc_STK25 15..291 CDD:270810 137/294 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.