DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and Myo3b

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_001380706.1 Gene:Myo3b / 366069 RGDID:1560313 Length:1333 Species:Rattus norvegicus


Alignment Length:281 Identity:139/281 - (49%)
Similarity:189/281 - (67%) Gaps:8/281 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LTALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNH 86
            |.:|.||...:|:.|.:|.||||:|||..:.:.|.|||:|::|...|.:||::.|.|:|:...:|
  Rat    33 LESLPDPMDTWEIRETIGKGTYGKVYKVANRRDGSLAAVKILDSVNDVDEEVEAEYNILQFLPSH 97

  Fly    87 RNIATYYGAFIK--KSPPGKDDQLWLVMEYCGAGSVTDLVKSTK--GQSLKEEWIAYICREILRG 147
            .|:..:||.|.|  :...|   |||||:|.|..||||:|||...  |:.|.|..|:||....|.|
  Rat    98 PNVVKFYGMFYKADRCVGG---QLWLVLELCNGGSVTELVKGLLRCGKRLDEALISYILYGSLLG 159

  Fly   148 LSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDEN 212
            |.:||.:::||||:||.|:|||....||||||||||||..|..||||.:|||:|||||||||::.
  Rat   160 LQHLHHHRIIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQQ 224

  Fly   213 PDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPR-LKSKKWSKKFHGFIDTV 276
            .|::||.|.|:|||||||:|:.:..|||.::||::.||.||||.||. |....|.::|:.||...
  Rat   225 YDSSYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFKIPRNPPPTLLHPDNWCEEFNHFISQC 289

  Fly   277 LVKDYHQRPYTENLLKHGFIK 297
            |:||:.:||...:||.|.|||
  Rat   290 LIKDFEKRPSVTHLLDHPFIK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 135/275 (49%)
S_TKc 32..296 CDD:214567 132/268 (49%)
CNH 1183..1484 CDD:214481
Myo3bNP_001380706.1 MYSc_Myo3 373..1062 CDD:276830
IQ 1102..1124 CDD:197470
PKc_like 20..310 CDD:419665 137/279 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.