DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and mbt

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster


Alignment Length:273 Identity:101/273 - (36%)
Similarity:157/273 - (57%) Gaps:17/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKL-EINVLKKYSNHRNIA 90
            ||....:....:|.|:.|.|.......||:..|:|.||:.:.:..|:.. |:.:::.| :|.||.
  Fly   363 DPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDY-HHPNIV 426

  Fly    91 TYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNK 155
            ..|.:|:      .:|:||:||||...|::||:|..::   :.||.||.:|::.|:.|:||||..
  Fly   427 ETYSSFL------VNDELWVVMEYLEGGALTDIVTHSR---MDEEQIATVCKQCLKALAYLHSQG 482

  Fly   156 VIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNR 220
            |||||||..::||..:..|||.|||..||:.:.:.:|.:.:||||||:||||:     ...|...
  Fly   483 VIHRDIKSDSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVIS-----RLPYGPE 542

  Fly   221 SDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLK-SKKWSKKFHGFIDTVLVKDYHQR 284
            .|:|||||..:||.:.:||..:..|::|:..|....||.|| :.|.|.:...|:|.:||:|..||
  Fly   543 VDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQR 607

  Fly   285 PYTENLLKHGFIK 297
            .....||.|.|::
  Fly   608 ATAAELLAHPFLR 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 100/270 (37%)
S_TKc 32..296 CDD:214567 98/265 (37%)
CNH 1183..1484 CDD:214481
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 101/271 (37%)
S_TKc 372..619 CDD:214567 98/261 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.