DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and sid1

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_593564.1 Gene:sid1 / 2542746 PomBaseID:SPAC9G1.09 Length:471 Species:Schizosaccharomyces pombe


Alignment Length:348 Identity:128/348 - (36%)
Similarity:188/348 - (54%) Gaps:44/348 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTE--DEEEEIKLEINVLKKYSNHRNIAT 91
            |..:.|:..:|:|::|.|:|.|...:|.:.|||.:|:..  |:..:|:.|:.:|.. .|..|:..
pombe     6 ANSYTLLRKLGSGSFGVVWKARENVSGDIIAIKQIDLETGIDDITDIEQEVFMLSN-CNSSNVIQ 69

  Fly    92 YYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKV 156
            |||.|:      ....||::||:...|||:.|:|..:   |.|:.|:.|.||:|.||:|||....
pombe    70 YYGCFV------DGYTLWILMEHMDGGSVSGLLKMGR---LNEQVISIILREVLYGLNYLHGQNK 125

  Fly   157 IHRDIKGQNVLLTDN-AEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNR 220
            ||||||..|:||:.: ..|||.||||:|||.....||:||:|||:|||||||     ...:|...
pombe   126 IHRDIKAANILLSSSTGNVKLADFGVAAQLSNAASRRHTFVGTPFWMAPEVI-----QQTSYGLA 185

  Fly   221 SDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRP 285
            :|:|||||||:|||...||...:||||.:|.||::.||:| ...:|..|..|:...|..:.:.|.
pombe   186 ADIWSLGITAIEMANGIPPRATMHPMRVIFEIPQSEPPKL-DDHFSPTFRDFVSCCLDLNPNMRW 249

  Fly   286 YTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLAGEHSSIV 350
            ..:.||:|.|||...|       :||.|...    .:||.:.:        ||..|      |::
pombe   250 SAKELLQHPFIKSAGT-------VKDIIPLL----VQKENKLF--------DDSDQ------SVL 289

  Fly   351 QAPGGDTLRRNFQQIQEGRLAAE 373
            :....:||:...:.|.||....|
pombe   290 EETINNTLKPFEEPIAEGNADIE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 109/269 (41%)
S_TKc 32..296 CDD:214567 108/266 (41%)
CNH 1183..1484 CDD:214481
sid1NP_593564.1 STKc_MST3_like 7..279 CDD:270786 117/298 (39%)
S_TKc 9..260 CDD:214567 108/266 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.