DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and ppk11

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_594517.1 Gene:ppk11 / 2541473 PomBaseID:SPAC2C4.14c Length:312 Species:Schizosaccharomyces pombe


Alignment Length:265 Identity:105/265 - (39%)
Similarity:158/265 - (59%) Gaps:16/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IEVVGNGTYGQVYKGRHTKTGQLAAIKV--MDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFI 97
            ::::|.|::|.|::.:..::.::.|:||  :|.|:|:.|.:..|||.|... |..:|..||.:|:
pombe     9 LQLIGQGSFGSVFRAQDVESSKIVALKVVDLDATKDQIETLTQEINFLIDL-NSVHITKYYASFV 72

  Fly    98 KKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIK 162
                  ...:||:.||||..||..||:|.:  .:..|..||.:.|::|..|.|||....:|||||
pombe    73 ------DGFRLWITMEYCDGGSCLDLLKLS--GTFSERVIAEVMRQVLEALVYLHGQGKMHRDIK 129

  Fly   163 GQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLG 227
            ..|:|...:..|||.|||||.||:....:.:.|:|||:||||||:     ....|:.::|:||||
pombe   130 AANILTMKDGLVKLADFGVSGQLESLRDKNDDFVGTPFWMAPEVV-----KQTGYNYKADIWSLG 189

  Fly   228 ITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292
            |||.|:|..:||...:|||:.|.|||::|||.|:..|:|:.|..|:...|.|:...|...|.|.|
pombe   190 ITAYELATGEPPYSGIHPMKVLLLIPKHSPPSLERSKFSRAFCDFVSNCLKKNPKDRATAEYLSK 254

  Fly   293 HGFIK 297
            |.|||
pombe   255 HKFIK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 102/262 (39%)
S_TKc 32..296 CDD:214567 102/262 (39%)
CNH 1183..1484 CDD:214481
ppk11NP_594517.1 STKc_MST3_like 4..278 CDD:270786 105/265 (40%)
S_TKc 6..258 CDD:214567 102/262 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.