DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and MYO3B

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:XP_011508956.1 Gene:MYO3B / 140469 HGNCID:15576 Length:1386 Species:Homo sapiens


Alignment Length:445 Identity:179/445 - (40%)
Similarity:249/445 - (55%) Gaps:51/445 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IDLTALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYS 84
            :.|.:|.||...:|:||.:|.||||:|||..:.:.|.|||:|::|...|.:|||:.|.|:|:...
Human    24 LGLESLPDPTDTWEIIETIGKGTYGKVYKVTNKRDGSLAAVKILDPVSDMDEEIEAEYNILQFLP 88

  Fly    85 NHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTK--GQSLKEEWIAYICREILRG 147
            ||.|:..:||.|. |:......|||||:|.|..||||:|||...  ||.|.|..|:||....|.|
Human    89 NHPNVVKFYGMFY-KADHCVGGQLWLVLELCNGGSVTELVKGLLRCGQRLDEAMISYILYGALLG 152

  Fly   148 LSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDEN 212
            |.:||:|::||||:||.|:|||....||||||||||||..|..||||.:|||:|||||||||::.
Human   153 LQHLHNNRIIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQQ 217

  Fly   213 PDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPR-LKSKKWSKKFHGFIDTV 276
            .|::||.|.|:|||||||:|:.:..|||.|:||::.||.||||.||. |..:||.::|:.||...
Human   218 YDSSYDARCDVWSLGITAIELGDGDPPLFDMHPVKTLFKIPRNPPPTLLHPEKWCEEFNHFISQC 282

  Fly   277 LVKDYHQRPYTENLLKHGFIKDQP-----TDRQVRIQLKD--HIDRCKKRKQEK--EREDYRYSG 332
            |:||:.:||...:||.|.|||...     ..:|:...|:|  |.:...|.:.|:  .|..|....
Human   283 LIKDFERRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVED 347

  Fly   333 SD----NDD-------DEP----QLAGEHSS-IVQAPGGDTL--RRNFQQI-----QEGRLAAEQ 374
            ::    .||       ||.    ||...::. ::....||.|  ...||.:     |..||    
Human   348 AEKYCLEDDLVNLEVLDEDTIIHQLQKRYADLLIYTYVGDILIALNPFQNLSIYSPQFSRL---- 408

  Fly   375 QQQHHLMAQAQAQA---AAAHAAAQAQAQLQQQQ-----QQAAAAAAAAAHAAQQ 421
               :|.:.:|....   |:|.||.|....|.:.|     .::.:....:||...|
Human   409 ---YHGVKRASNPPHIFASADAAYQCMVTLSKDQCIVISGESGSGKTESAHLIVQ 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 141/273 (52%)
S_TKc 32..296 CDD:214567 138/266 (52%)
CNH 1183..1484 CDD:214481
MYO3BXP_011508956.1 STKc_myosinIIIB_N 13..303 CDD:270808 143/279 (51%)
S_TKc 36..302 CDD:214567 138/266 (52%)
MYSc 355..1062 CDD:214580 26/113 (23%)
MYSc_Myo3 366..1055 CDD:276830 22/102 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2204
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.