DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msn and stk26

DIOPT Version :9

Sequence 1:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster
Sequence 2:NP_001120949.1 Gene:stk26 / 100151762 ZFINID:ZDB-GENE-080516-5 Length:412 Species:Danio rerio


Alignment Length:359 Identity:146/359 - (40%)
Similarity:204/359 - (56%) Gaps:51/359 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDV--TEDEEEEIKLEINVLKKYSNHRNI 89
            ||..:|..::.:|.|::|:|:||...:|..:.|||.:|:  .|||.|:|:.||.||.: .:..::
Zfish    19 DPEELFTKLDRIGKGSFGEVFKGIDRQTQNVVAIKTIDLEEAEDEIEDIQQEITVLSQ-CDSPHV 82

  Fly    90 ATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSN 154
            ..|||:::|.|      :||::|||.|.||..||:::   ....|..||.:.:|||:||.||||.
Zfish    83 TKYYGSYLKGS------KLWIIMEYLGGGSALDLLRA---GPFDEYQIATMLKEILKGLDYLHSE 138

  Fly   155 KVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDN 219
            |.||||||..||||:::.||||.||||:.||..|..:|.||:|||:|||||||     ..:.||:
Zfish   139 KKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKRETFVGTPFWMAPEVI-----QQSAYDS 198

  Fly   220 RSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQR 284
            ::|:|||||||:|:|:.:||..|:||||.||.||:|:||.|.. .:||.|..|:|:.|.||...|
Zfish   199 KADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKNTPPTLNG-DFSKIFKEFVDSCLNKDPAFR 262

  Fly   285 PYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKERE-------DYRYSGSDND------ 336
            |..:.||||.||...........:|   |||.|:.|.|...:       |...|..|||      
Zfish   263 PTAKELLKHKFIVKYAKKTSYLTEL---IDRLKRWKAEGHSDGESSSDSDSETSSKDNDSSPEWS 324

  Fly   337 -----------------DDEPQLAGEHSSIVQAP 353
                             |:|.|......:.|.||
Zfish   325 FTTVRKKKTEKKQPNGTDEELQKKSASLTTVMAP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 126/270 (47%)
S_TKc 32..296 CDD:214567 124/265 (47%)
CNH 1183..1484 CDD:214481
stk26NP_001120949.1 STKc_MST3_like 22..295 CDD:270786 131/291 (45%)
S_TKc 24..274 CDD:214567 124/265 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.