DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and SAFB2

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_055464.1 Gene:SAFB2 / 9667 HGNCID:21605 Length:953 Species:Homo sapiens


Alignment Length:124 Identity:37/124 - (29%)
Similarity:54/124 - (43%) Gaps:18/124 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GAVQKAKFPRGDVNSAWKHDMYDGP----KRGAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFG 133
            ||.||.        |::|.:....|    ::|.||.||| ..|.|..|......||:|.||:.:|
Human   376 GADQKM--------SSFKEEKDIKPIIKDEKGRVGSGSG-RNLWVSGLSSTTRATDLKNLFSKYG 431

  Fly   134 PIKKAAVHYDRSGRSLGT---ADVIFERRADALKAIKQYHGVPLDGRPMTIQLAVSDVA 189
            .:..|.|  ..:.||.|.   ..|......:|.|.|...|...|.||.::::.|.::.|
Human   432 KVVGAKV--VTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPA 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 35/117 (30%)
RRM_THOC4 109..183 CDD:410081 22/76 (29%)
FoP_duplication 202..>260 CDD:464005
SAFB2NP_055464.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
SAP 30..64 CDD:128789
PLN03124 31..>153 CDD:215591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..114
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..404 10/35 (29%)
RRM_SAFB1_SAFB2 406..481 CDD:410080 23/77 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..665
Interaction with SAFB1 600..953
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..953
Nuclear localization signal. /evidence=ECO:0000255 713..730
RcnB 756..>843 CDD:444206
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.