DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and NGR1

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_009771.3 Gene:NGR1 / 852513 SGDID:S000000416 Length:672 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:22/73 - (30%)
Similarity:36/73 - (49%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 TRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVP 173
            |.:.||.|....:...::.||..||||....:   .:|::.|.  |.||:|.||..:|:...|..
Yeast   360 TTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI---PNGKNCGF--VKFEKRIDAEASIQGLQGFI 419

  Fly   174 LDGRPMTI 181
            :.|.|:.:
Yeast   420 VGGSPIRL 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 22/73 (30%)
RRM_THOC4 109..183 CDD:410081 22/73 (30%)
FoP_duplication 202..>260 CDD:464005
NGR1NP_009771.3 RRM1_NGR1_NAM8_like 35..180 CDD:410023
RRM2_NGR1_NAM8_like 191..270 CDD:410025
RRM3_NGR1_NAM8_like 359..430 CDD:409782 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.