DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and AT1G76460

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_565132.2 Gene:AT1G76460 / 843979 AraportID:AT1G76460 Length:285 Species:Arabidopsis thaliana


Alignment Length:77 Identity:23/77 - (29%)
Similarity:37/77 - (48%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 TRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDR-SGRSLGTADVIFERRADALKAIKQYHGV 172
            |::.||.|.:...:..:::.|..:|.|.:|.|..|: :|||.|...|.|.....|.:|......:
plant    24 TKVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPI 88

  Fly   173 PLDGRPMTIQLA 184
             :|||.....||
plant    89 -IDGRRANCNLA 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 21/75 (28%)
RRM_THOC4 109..183 CDD:410081 21/74 (28%)
FoP_duplication 202..>260 CDD:464005
AT1G76460NP_565132.2 RRM_RBM24_RBM38_like 24..99 CDD:409818 21/75 (28%)
PABP-1234 <37..245 CDD:130689 19/64 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.