DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and POLDIP3

DIOPT Version :9

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001265586.1 Gene:POLDIP3 / 84271 HGNCID:23782 Length:438 Species:Homo sapiens


Alignment Length:145 Identity:41/145 - (28%)
Similarity:59/145 - (40%) Gaps:46/145 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 TRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVP 173
            |::.|.||...|:..||.|||...|.:|:|.:.:.      |.|:|:|.::.||:.|.|:|:...
Human   297 TKMTVNNLHPRVTEEDIVELFCVCGALKRARLVHP------GVAEVVFVKKDDAITAYKKYNNRC 355

  Fly   174 LDGRPMTIQL------AVSDVAVLTRPVAATDVK------RRVGG-------------------- 206
            |||:||...|      ..||..:|.|...:..:|      |||..                    
Human   356 LDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILKALF 420

  Fly   207 --------TAPTSFK 213
                    |.||.||
Human   421 KSSGASVTTQPTEFK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 RRM <108..>187 CDD:223796 28/83 (34%)
RRM_THOC4 109..183 CDD:241124 27/73 (37%)
FoP_duplication 214..>265 CDD:290576 41/145 (28%)
POLDIP3NP_001265586.1 RRM_SKAR 297..365 CDD:241125 27/73 (37%)
RRM <301..424 CDD:223796 35/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.