DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and SC35

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:152 Identity:42/152 - (27%)
Similarity:63/152 - (41%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GGSGPT------RLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYD-RSGRSLGTADVIFERRAD 161
            |.|||.      .|:|.|:.:..:..|:..||..:|.:....:..| |:|.|.|.|.|.::.:.:
plant     5 GRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDE 69

  Fly   162 ALKAIKQYHGVPLDGRPMTIQLAVSDVAVLTRPVAATDVKRRVGGTAPTSFKRGGGQAGGTARRG 226
            |.||:::..|..:|||.:|:|.|...      |.|....|.||....|.|            ||.
plant    70 AHKAVERLDGRVVDGREITVQFAKYG------PNAEKISKGRVVEPPPKS------------RRS 116

  Fly   227 FKRPVGGKPAAGGQRRERKAPP 248
            ..|    .|......|..::||
plant   117 RSR----SPRRSRSPRRSRSPP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 27/86 (31%)
RRM_THOC4 109..183 CDD:410081 22/80 (28%)
FoP_duplication 202..>260 CDD:464005 11/47 (23%)
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 22/71 (31%)
PHA03307 <204..>303 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.