DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and AT5G19350

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_197436.1 Gene:AT5G19350 / 832055 AraportID:AT5G19350 Length:425 Species:Arabidopsis thaliana


Alignment Length:89 Identity:27/89 - (30%)
Similarity:44/89 - (49%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GGG----SGPTR-LIVGNLDYGVSNTDIKELFN-DFGPIKKAAVHYDRS-GRSLGTADVIFERRA 160
            |.|    :||.. :.||:|...|::..::|.|. .:..::.|.|..|.| |||.|...|.|...:
plant   105 GSGQKVDAGPDHSIFVGDLAPDVTDYLLQETFRVHYSSVRGAKVVTDPSTGRSKGYGFVKFAEES 169

  Fly   161 DALKAIKQYHGVPLDGRPMTIQLA 184
            :..:|:.:.:|:....|||.|..|
plant   170 ERNRAMAEMNGLYCSTRPMRISAA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 26/87 (30%)
RRM_THOC4 109..183 CDD:410081 22/76 (29%)
FoP_duplication 202..>260 CDD:464005
AT5G19350NP_197436.1 RRM1_SECp43_like 25..105 CDD:409780 27/89 (30%)
RRM2_SECp43_like 115..194 CDD:409781 23/79 (29%)
RRM_SF 237..306 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.