DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and ATRZ-1A

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_189273.1 Gene:ATRZ-1A / 822246 AraportID:AT3G26420 Length:245 Species:Arabidopsis thaliana


Alignment Length:136 Identity:37/136 - (27%)
Similarity:58/136 - (42%) Gaps:31/136 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDR-SGRSLGTADVIFERRADALKAIKQYHGVP 173
            |..:|.|.:..|:..:::.|..:|.:.:|.|..|: ||||.|...:.|:.:....:||...:|:.
plant     8 RCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMD 72

  Fly   174 LDGRPMTIQLAVSDVAVLTRPVAATDVKRRVGGTAPTSFKRGGGQAGGTAR-RGF----KRPVGG 233
            ||||.:|:..|                :...||.       |....|...| ||:    .||.||
plant    73 LDGRTITVDKA----------------QPHQGGA-------GRDNDGDRGRDRGYDRDRSRPSGG 114

  Fly   234 KPAAGG 239
            :  .||
plant   115 R--GGG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 23/74 (31%)
RRM_THOC4 109..183 CDD:410081 23/73 (32%)
FoP_duplication 202..>260 CDD:464005 13/43 (30%)
ATRZ-1ANP_189273.1 RRM2_NsCP33_like 8..83 CDD:410187 23/74 (31%)
ZnF_C2HC 120..135 CDD:197667
U2AF_lg 136..>242 CDD:273727
PRK04537 <208..240 CDD:235307
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.