DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and RS2Z33

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_850280.1 Gene:RS2Z33 / 818311 AraportID:AT2G37340 Length:290 Species:Arabidopsis thaliana


Alignment Length:78 Identity:22/78 - (28%)
Similarity:33/78 - (42%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHG 171
            |.|||.||.|.......|::.||:.:|.::...:..|       .|.|.|....||..|.....|
plant     9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD-------YAFVEFGDPRDADDARHYLDG 66

  Fly   172 VPLDGRPMTIQLA 184
            ...||..:|::.:
plant    67 RDFDGSRITVEFS 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 22/76 (29%)
RRM_THOC4 109..183 CDD:410081 21/73 (29%)
FoP_duplication 202..>260 CDD:464005
RS2Z33NP_850280.1 RRM_SF 12..81 CDD:473069 20/75 (27%)
PTZ00368 <86..144 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.