DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and tia1

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_997793.1 Gene:tia1 / 793165 ZFINID:ZDB-GENE-030131-1506 Length:386 Species:Danio rerio


Alignment Length:68 Identity:26/68 - (38%)
Similarity:35/68 - (51%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYD-RSGRSLGTADVIFERRADALKAIKQYHGVPL 174
            :.||:|...::..||:..|..||.|..|.|..| .:|:|.|...|.|..:.||..||:|..|..|
Zfish    98 VFVGDLSPEITTDDIRAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWL 162

  Fly   175 DGR 177
            .||
Zfish   163 GGR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 26/68 (38%)
RRM_THOC4 109..183 CDD:410081 26/68 (38%)
FoP_duplication 202..>260 CDD:464005
tia1NP_997793.1 RRM1_TIA1 9..82 CDD:410027
RRM2_TIA1 94..171 CDD:410030 26/68 (38%)
RRM3_TIA1 204..275 CDD:410032
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.