DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Boll

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001355696.1 Gene:Boll / 75388 MGIID:1922638 Length:340 Species:Mus musculus


Alignment Length:90 Identity:25/90 - (27%)
Similarity:48/90 - (53%) Gaps:4/90 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GPKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRA 160
            ||:.|.|    .|.|:.||.:|:..:..|:::.|:.:|.:|:..:..||:|.|.|...:.||.:.
Mouse    36 GPRYGTV----IPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFITFETQE 96

  Fly   161 DALKAIKQYHGVPLDGRPMTIQLAV 185
            ||.|.:::...:....:.:.|..|:
Mouse    97 DAQKILQEAEKLNYKDKKLNIGPAI 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 24/87 (28%)
RRM_THOC4 109..183 CDD:410081 19/73 (26%)
FoP_duplication 202..>260 CDD:464005
BollNP_001355696.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 2/2 (100%)
RRM_BOULE 43..123 CDD:410074 21/79 (27%)
PABP-1234 <45..293 CDD:130689 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.