DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and RBM11

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001307531.1 Gene:RBM11 / 54033 HGNCID:9897 Length:288 Species:Homo sapiens


Alignment Length:72 Identity:24/72 - (33%)
Similarity:35/72 - (48%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLD 175
            :.||||:..|....:.|||...||:.|..:..||.|:......|.|:.......||...:|:.|.
Human    12 VFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLY 76

  Fly   176 GRPMTIQ 182
            |||:.:|
Human    77 GRPINVQ 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 24/72 (33%)
RRM_THOC4 109..183 CDD:410081 24/72 (33%)
FoP_duplication 202..>260 CDD:464005
RBM11NP_001307531.1 RRM_RBM11 9..83 CDD:410006 23/70 (33%)
PABP-1234 <12..223 CDD:130689 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.