DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Boll

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001419438.1 Gene:Boll / 501143 RGDID:1559527 Length:340 Species:Rattus norvegicus


Alignment Length:110 Identity:28/110 - (25%)
Similarity:55/110 - (50%) Gaps:13/110 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GPKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRA 160
            ||:.|.|    .|.|:.||.:|:..:..|:::.|:.:|.:|:..:..||:|.|.|...:.||.:.
  Rat    36 GPRYGTV----IPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFITFETQE 96

  Fly   161 DALKAIKQYHGVPLDGRPMTI-------QLAVSDVAVLTRPVAAT 198
            ||.|.:::...:....:.:.|       |:.:...:::  |.|.|
  Rat    97 DAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIM--PAAGT 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 25/94 (27%)
RRM_THOC4 109..183 CDD:410081 19/80 (24%)
FoP_duplication 202..>260 CDD:464005
BollNP_001419438.1 RRM_BOULE 43..123 CDD:410074 20/79 (25%)
PABP-1234 <45..293 CDD:130689 23/97 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.