DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and NCL

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_005372.2 Gene:NCL / 4691 HGNCID:7667 Length:710 Species:Homo sapiens


Alignment Length:71 Identity:23/71 - (32%)
Similarity:40/71 - (56%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLD 175
            |:..||.|.|:..::||:|.|...|:..:    :.|:|.|.|.:.|:..|||.|..::..|..:|
Human   395 LLAKNLPYKVTQDELKEVFEDAAEIRLVS----KDGKSKGIAYIEFKTEADAEKTFEEKQGTEID 455

  Fly   176 GRPMTI 181
            ||.:::
Human   456 GRSISL 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 23/71 (32%)
RRM_THOC4 109..183 CDD:410081 23/71 (32%)
FoP_duplication 202..>260 CDD:464005
NCLNP_005372.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..303
8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X 58..135
RRM1_NCL 307..381 CDD:409837
RRM2_NCL 390..465 CDD:409838 23/71 (32%)
RRM3_NCL 485..557 CDD:409839
RRM4_NCL 572..649 CDD:409840
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 640..710
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.