DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and rbm24a

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_998030.1 Gene:rbm24a / 405801 ZFINID:ZDB-GENE-040628-1 Length:230 Species:Danio rerio


Alignment Length:77 Identity:26/77 - (33%)
Similarity:44/77 - (57%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 TRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDR-SGRSLGTADVIFERRADALKAIKQYHGV 172
            |::.||.|.|..:::.:::.|..||.|::|.|..|| :|:|.|...|....|:.|.:|.|..:.:
Zfish    11 TKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDPNPI 75

  Fly   173 PLDGRPMTIQLA 184
             :|||...:.||
Zfish    76 -IDGRKANVNLA 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 24/75 (32%)
RRM_THOC4 109..183 CDD:410081 24/74 (32%)
FoP_duplication 202..>260 CDD:464005
rbm24aNP_998030.1 RRM_RBM24_RBM38_like 11..86 CDD:409818 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.