DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and srsf7a

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_991236.1 Gene:srsf7a / 402972 ZFINID:ZDB-GENE-040426-1798 Length:258 Species:Danio rerio


Alignment Length:75 Identity:20/75 - (26%)
Similarity:38/75 - (50%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPL 174
            ::.||:|..|.:..:::..|:.:||::...|    :....|.|.|.:|...||..|:|...|..|
Zfish    15 KVYVGDLGNGAAKGELERAFSYYGPLRSVWV----ARNPPGFAFVEYEDARDAEDAVKGMDGKVL 75

  Fly   175 DGRPMTIQLA 184
            .|..:.::|:
Zfish    76 CGARVRVELS 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 19/73 (26%)
RRM_THOC4 109..183 CDD:410081 19/72 (26%)
FoP_duplication 202..>260 CDD:464005
srsf7aNP_991236.1 RRM_SF 15..91 CDD:473069 20/75 (27%)
zf-CCHC 106..121 CDD:395050
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.