DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Rbp6

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster


Alignment Length:134 Identity:36/134 - (26%)
Similarity:55/134 - (41%) Gaps:23/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KAKFPRGDVNSAWKH-DMYDGPKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAV 140
            |..|||.      .| .|....|:..|||.|.||.|           .|:|..|..||||:.|.:
  Fly   102 KVAFPRR------AHPKMVTRTKKIFVGGLSAPTTL-----------EDVKSYFEQFGPIEDAML 149

  Fly   141 HYDR-SGRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQLAVSDVAVLTRPVAATDVKRRV 204
            .:|: :.|..|...|.|:.. |.:..:.:.|...::.:.:..:.|.....:|...:|.|   |..
  Fly   150 MFDKQTNRHRGFGFVTFQSE-DVVDKVCEIHFHEINNKMVECKK
AQPKEVMLPANLAKT---RAA 210

  Fly   205 GGTA 208
            |.:|
  Fly   211 GRSA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 29/108 (27%)
RRM_THOC4 109..183 CDD:410081 17/74 (23%)
FoP_duplication 202..>260 CDD:464005 3/7 (43%)
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 1/2 (50%)
RRM2_MSI 119..192 CDD:240769 22/84 (26%)

Return to query results.
Submit another query.