DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and tia1

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_012814227.2 Gene:tia1 / 394890 XenbaseID:XB-GENE-1002876 Length:389 Species:Xenopus tropicalis


Alignment Length:68 Identity:27/68 - (39%)
Similarity:34/68 - (50%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYD-RSGRSLGTADVIFERRADALKAIKQYHGVPL 174
            :.||:|...::..|||..|..||.|..|.|..| .:|:|.|...|.|..:.||..||.|..|..|
 Frog   108 VFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWL 172

  Fly   175 DGR 177
            .||
 Frog   173 GGR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 27/68 (40%)
RRM_THOC4 109..183 CDD:410081 27/68 (40%)
FoP_duplication 202..>260 CDD:464005
tia1XP_012814227.2 RRM1_TIA1 8..81 CDD:410027
RRM2_TIA1 104..181 CDD:410030 27/68 (40%)
RRM3_TIAR 214..286 CDD:241064
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.