DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and PABPN1L

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001372638.1 Gene:PABPN1L / 390748 HGNCID:37237 Length:297 Species:Homo sapiens


Alignment Length:67 Identity:19/67 - (28%)
Similarity:23/67 - (34%) Gaps:26/67 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GARRGGANAGGSPRKPGSVLKGPRGGVAAGAVQKAKFPRGDVNSAWKHDMYDGPKRGAVGGGSGP 108
            |.|.|...||..|      |.||.   ..||.:|.:.|       |  |....|:        ||
Human   163 GLRAGRRGAGPEP------LPGPG---HQGAAEKNQLP-------W--DQLHRPR--------GP 201

  Fly   109 TR 110
            :|
Human   202 SR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 19/67 (28%)
RRM_THOC4 109..183 CDD:410081 1/2 (50%)
FoP_duplication 202..>260 CDD:464005
PABPN1LNP_001372638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..128
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.