DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and TBPH

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:70 Identity:20/70 - (28%)
Similarity:33/70 - (47%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 TRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYD-RSGRSLGTADVIFERRADALKAIKQYHGV 172
            |.|||..|.:..:...::|.|..:|.:..|.:..| :||:|.|...|.|......::.:...|  
  Fly   107 TDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRH-- 169

  Fly   173 PLDGR 177
            .:|||
  Fly   170 LIDGR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 20/70 (29%)
RRM_THOC4 109..183 CDD:410081 20/70 (29%)
FoP_duplication 202..>260 CDD:464005
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 19/69 (28%)
RRM2_TDP43 192..261 CDD:409761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.