DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref1 and Srsf10

DIOPT Version :10

Sequence 1:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_006239282.1 Gene:Srsf10 / 362630 RGDID:1311067 Length:262 Species:Rattus norvegicus


Alignment Length:80 Identity:26/80 - (32%)
Similarity:35/80 - (43%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 TRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYD-RSGRSLGTADVIFERRADALKAIKQYHGV 172
            |.|.|.|:.....:.|::..|..:|||....|..| .:.|..|.|.|.||...||..|:......
  Rat    10 TSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRK 74

  Fly   173 PLDGRPMTIQLAVSD 187
            .:.||.:.||.|..|
  Rat    75 WICGRQIEIQFAQGD 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 24/75 (32%)
RRM_THOC4 109..183 CDD:410081 23/74 (31%)
FoP_duplication 202..>260 CDD:464005
Srsf10XP_006239282.1 RRM_SF 5..99 CDD:473069 26/80 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.